PEPTIDE NOVA

LL-37 5MG

Original price was: $64.99.Current price is: $44.99.

Sale!

Description

Product Overview

LL-37 is a synthetic peptide referenced in scientific literature and studied in peptide research involving antimicrobial peptide signaling, cell signaling pathways, and molecular regulatory mechanisms. Within controlled laboratory and preclinical research environments, LL-37 is investigated as a laboratory peptide compound for its amino acid sequence, structural properties, and interaction with experimental cellular and molecular systems.

As a synthetic peptide compound, LL-37 is utilized in experimental studies to investigate peptide molecular structure, peptide signaling pathways, and laboratory peptide characterization, providing insight into molecular regulatory networks and signaling dynamics in preclinical research models.

LL-37 is a synthetic cationic antimicrobial peptide derived from the human cathelicidin antimicrobial protein (hCAP18). It is classified as a synthetic signaling peptide studied in laboratory research for its interactions with cellular signaling pathways, receptor-mediated molecular communication, and regulatory peptide networks.

Researchers study LL-37 to examine peptide sequence behavior, receptor interactions, and intracellular signaling mechanisms. Its amino acid sequence and molecular structure are analyzed in laboratory and preclinical research models to better understand peptide signaling pathways, molecular regulatory mechanisms, and cell signaling research.

Experimental studies involving LL-37 include:

  • peptide signaling pathways

  • cell signaling research

  • receptor binding interactions

  • antimicrobial peptide research

  • molecular signaling mechanisms

  • peptide stability and structural activity

  • laboratory peptide characterization

  • intracellular signaling cascade analysis

  • inflammatory pathway research

All studies are conducted strictly in controlled laboratory and preclinical research environments.

Compound Name: LL-37
Peptide Classification: Synthetic cationic antimicrobial peptide (human cathelicidin fragment)
Molecular Formula: C177H303N51O51
Molecular Weight: ~4493.0 g/mol
Amino Acid Sequence: [LL-37, 37 aa]
CAS Number: Referenced in scientific literature

LL-37 is a synthetic peptide designed for laboratory investigation of peptide signaling pathways, molecular regulatory mechanisms, and receptor-mediated intracellular communication. Researchers study its peptide molecular structure and sequence using techniques such as chromatography, mass spectrometry, and laboratory peptide characterization to assess structural integrity, sequence stability, and signaling potential.

Scientific literature has examined LL-37 in experimental and preclinical studies investigating peptide signaling pathways, antimicrobial peptide interactions, and molecular regulatory mechanisms.

In research models, LL-37 has been studied in relation to cellular signaling cascades, peptide-mediated molecular interactions, and intracellular communication networks. All investigations are conducted strictly in controlled laboratory or preclinical research environments, focusing solely on the scientific characterization of this synthetic peptide compound.

Compound Name: LL-37
Peptide Classification: Synthetic cationic antimicrobial peptide (human cathelicidin fragment)
Format: Lyophilized Powder
Quantity: 5MG
Research Category: Peptide research / molecular signaling research / laboratory peptide characterization
Storage Recommendations: Store refrigerated in a cool, dry environment protected from light and moisture. Long-term storage under controlled laboratory refrigeration is recommended.

Research Use Only. Not for human or veterinary use. Not approved by the FDA and not intended to diagnose, treat, cure, or prevent any disease.

Links To Research Studies

AS SEEN ON

Infinite Logo Marquee
logo1 logo2 logo3 logo4 logo1-duplicate logo2-duplicate logo3-duplicate logo4-duplicate

Legal Disclaimer

For research purposes only. Not for consumption, clinical use, or diagnostic purposes. Buyer assumes all responsibility for proper handling and use in compliance with applicable regulations.

Satisfaction Guaranteed

30-Day Replacement Policy

Customer Service

Chat, Phone & E-Mail

Fast Shipping

Priority Shipping

Quality Tested

Third-Party Tested

You May Also Like