All peptides are tested for purity and identity.
For laboratory research purposes only.
On all orders over $150 delivered within the U.S.A.
As a top research supplier, we can meet any quantity demand.
Product Name: LL-37
Product Code: LL37-5MG
Batch Number: BT2505LL37
Catalog Number: RC-LL37-5MG
Strength: 5MG
CAS Number: 154947-66-7
Molecular Formula: C₁₇₇H₃₀₃N₅₁O₅₁
Molecular Weight: ~4493 g/mol
Amino Acid Sequence: [LL-37, 37 aa]
Peptide Classification: Synthetic cationic antimicrobial peptide (human cathelicidin fragment)
Form: Lyophilized Powder
Original price was: $64.99.$44.99Current price is: $44.99.
All products are intended for in vitro research applications in laboratory settings.
Detailed COA’s for all products available upon request
Rigorous testing ensures consistency. purity. and reliability.
Shipping with tracking number provided for every shipment.
